Lineage for d2ct1a2 (2ct1 A:8-43)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462985Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1462986Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1462987Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1463083Protein Transcriptional repressor CTCF [144153] (1 species)
  7. 1463084Species Human (Homo sapiens) [TaxId:9606] [144154] (2 PDB entries)
    Uniprot P49711 399-434! Uniprot P49711 435-462! Uniprot P49711 515-550! Uniprot P49711 551-587
  8. 1463086Domain d2ct1a2: 2ct1 A:8-43 [130789]
    ZnF 6
    complexed with zn

Details for d2ct1a2

PDB Entry: 2ct1 (more details)

PDB Description: solution structure of the zinc finger domain of transcriptional repressor ctcf protein
PDB Compounds: (A:) Transcriptional repressor CTCF

SCOPe Domain Sequences for d2ct1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}
rthsgekpyecyicharftqsgtmkmhilqkhtenv

SCOPe Domain Coordinates for d2ct1a2:

Click to download the PDB-style file with coordinates for d2ct1a2.
(The format of our PDB-style files is described here.)

Timeline for d2ct1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ct1a1