SCOPe 2.08: Domain d2ct1a2: 2ct1 A:8-43

Lineage for d2ct1a2 (2ct1 A:8-43)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein Transcriptional repressor CTCF [144153] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144154] (2 PDB entries)
   Uniprot P49711 399-434! Uniprot P49711 435-462! Uniprot P49711 515-550! Uniprot P49711 551-587

8. Domain d2ct1a2: 2ct1 A:8-43 [130789]
   Other proteins in same PDB: d2ct1a3, d2ct1a4
   ZnF 6
   complexed with zn

Details for d2ct1a2

PDB Entry: 2ct1

PDB Description: solution structure of the zinc finger domain of transcriptional repressor ctcf protein

PDB Compounds: (A:) Transcriptional repressor CTCF

SCOPe Domain Sequences for d2ct1a2:

Sequence; same for both SEQRES and ATOM records:

>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}
rthsgekpyecyicharftqsgtmkmhilqkhtenv

Timeline for d2ct1a2:

• d2ct1a2 first appeared in SCOP 1.73
  
• d2ct1a2 appears in SCOPe 2.07