SCOP 1.73: Domain d2ct1a2: 2ct1 A:8-43

Lineage for d2ct1a2 (2ct1 A:8-43)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
   alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix

4. Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (6 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)

6. Protein Transcriptional repressor CTCF [144153] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144154] (2 PDB entries)

8. Domain d2ct1a2: 2ct1 A:8-43 [130789]
   ZnF 6
   complexed with zn

Details for d2ct1a2

PDB Entry: 2ct1

PDB Description: solution structure of the zinc finger domain of transcriptional repressor ctcf protein

PDB Compounds: (A:) Transcriptional repressor CTCF

SCOP Domain Sequences for d2ct1a2:

Sequence; same for both SEQRES and ATOM records:

>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]}
rthsgekpyecyicharftqsgtmkmhilqkhtenv

Timeline for d2ct1a2:

• d2ct1a2 is new in SCOP 1.73
  
• d2ct1a2 appears in SCOP 1.75
  
• d2ct1a2 appears in the current release, SCOPe 2.08