SCOPe 2.06: Domain d2cseu1: 2cse U:587-660

Lineage for d2cseu1 (2cse U:587-660)

1. Root: SCOPe 2.06

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.7: Reovirus components [58175] (1 superfamily)

4. Superfamily i.7.1: Reovirus components [58176] (1 family)

5. Family i.7.1.1: Reovirus components [58177] (3 proteins)

6. Protein outer-capsid protein mu1 and reovirus core [144308] (1 species)

7. Species Mammalian orthoreovirus 3 [TaxId:538123] [144309] (1 PDB entry)

8. Domain d2cseu1: 2cse U:587-660 [130766]
   Other proteins in same PDB: d2csed1, d2csee1, d2csef1, d2cseg1, d2cseh1, d2csei1, d2csem1, d2csen1, d2cseo1, d2cses1

Details for d2cseu1

PDB Entry: 2cse, 7 Å

PDB Description: features of reovirus outer-capsid protein mu1 revealed by electron and image reconstruction of the virion at 7.0-a resolution

PDB Compounds: (U:) guanylyltransferase

SCOPe Domain Sequences for d2cseu1:

Sequence; same for both SEQRES and ATOM records:

>d2cseu1 i.7.1.1 (U:587-660) outer-capsid protein mu1 and reovirus core {Mammalian orthoreovirus 3 [TaxId: 538123]}
dlsissglvesllsscmhatapggsfvvkinfptrpvwhyieqkilpnitsymlikpfvt
nnvelffvafgvhq

Timeline for d2cseu1:

• d2cseu1 first appeared in SCOP 1.73
  
• d2cseu1 appears in SCOPe 2.05
  
• d2cseu1 appears in SCOPe 2.07
  
• d2cseu1 appears in the current release, SCOPe 2.08