Lineage for d2cseu1 (2cse U:587-660)

  1. Root: SCOPe 2.06
  2. 2268314Class i: Low resolution protein structures [58117] (25 folds)
  3. 2270426Fold i.7: Reovirus components [58175] (1 superfamily)
  4. 2270427Superfamily i.7.1: Reovirus components [58176] (1 family) (S)
  5. 2270428Family i.7.1.1: Reovirus components [58177] (3 proteins)
  6. 2270432Protein outer-capsid protein mu1 and reovirus core [144308] (1 species)
  7. 2270433Species Mammalian orthoreovirus 3 [TaxId:538123] [144309] (1 PDB entry)
  8. 2270434Domain d2cseu1: 2cse U:587-660 [130766]
    Other proteins in same PDB: d2csed1, d2csee1, d2csef1, d2cseg1, d2cseh1, d2csei1, d2csem1, d2csen1, d2cseo1, d2cses1

Details for d2cseu1

PDB Entry: 2cse (more details), 7 Å

PDB Description: features of reovirus outer-capsid protein mu1 revealed by electron and image reconstruction of the virion at 7.0-a resolution
PDB Compounds: (U:) guanylyltransferase

SCOPe Domain Sequences for d2cseu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cseu1 i.7.1.1 (U:587-660) outer-capsid protein mu1 and reovirus core {Mammalian orthoreovirus 3 [TaxId: 538123]}
dlsissglvesllsscmhatapggsfvvkinfptrpvwhyieqkilpnitsymlikpfvt
nnvelffvafgvhq

SCOPe Domain Coordinates for d2cseu1:

Click to download the PDB-style file with coordinates for d2cseu1.
(The format of our PDB-style files is described here.)

Timeline for d2cseu1: