Lineage for d2csei1 (2cse I:1-365)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238380Fold d.196: Outer capsid protein sigma 3 [64464] (1 superfamily)
    unusual fold
  4. 2238381Superfamily d.196.1: Outer capsid protein sigma 3 [64465] (1 family) (S)
    automatically mapped to Pfam PF00979
  5. 2238382Family d.196.1.1: Outer capsid protein sigma 3 [64466] (1 protein)
  6. 2238383Protein Outer capsid protein sigma 3 [64467] (1 species)
  7. 2238384Species Reovirus [TaxId:10891] [64468] (3 PDB entries)
  8. 2238395Domain d2csei1: 2cse I:1-365 [130761]
    Other proteins in same PDB: d2cseu1
    automatically matched to d1jmug_

Details for d2csei1

PDB Entry: 2cse (more details), 7 Å

PDB Description: features of reovirus outer-capsid protein mu1 revealed by electron and image reconstruction of the virion at 7.0-a resolution
PDB Compounds: (I:) major capsid surface protein sigma-3

SCOPe Domain Sequences for d2csei1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2csei1 d.196.1.1 (I:1-365) Outer capsid protein sigma 3 {Reovirus [TaxId: 10891]}
mevclpnghqivdlinnafegrvsiysaqegwdktisaqpdmmvcggavvcmhclgvvgs
lqrklkhlphhrcnqqirhqdyvdvqfadrvtahwkrgmlsfvcqmhammndvspedldr
vrteggslvelnwlqvdpnsmfrsihsswtdplqvvddldtkldqywtalnlmidssdlv
pnfmmrdpshafngvrlegdarqtqfsrtfdsrsslewgvmvydyselehdpskgrayrk
elvtpardfghfglshysrattpilgkmpavfsgmltgnckmypfikgtaklktvrklvd
svnhawgvekiryalgpggmtgwynrtmqqapivltpaaltmfsdttkfgdldypvmigd
pmilg

SCOPe Domain Coordinates for d2csei1:

Click to download the PDB-style file with coordinates for d2csei1.
(The format of our PDB-style files is described here.)

Timeline for d2csei1: