Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Telokin [49170] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141012] (1 PDB entry) Uniprot Q9UIT9 1238-1338 |
Domain d2cqva1: 2cqv A:8-108 [130730] |
PDB Entry: 2cqv (more details)
SCOPe Domain Sequences for d2cqva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} pqiiqfpedqkvragesvelfgkvtgtqpitctwmkfrkqiqesehmkvensengsklti laarqehcgcytllvenklgsrqaqvnltvvdkpdppagtp
Timeline for d2cqva1: