SCOP 1.73: Domain d2cqva1: 2cqv A:8-108

Lineage for d2cqva1 (2cqv A:8-108)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (36 proteins)

6. Protein Telokin [49170] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141012] (1 PDB entry)

8. Domain d2cqva1: 2cqv A:8-108 [130730]

Details for d2cqva1

PDB Entry: 2cqv

PDB Description: solution structure of the eighth ig-like domain of human myosin light chain kinase

PDB Compounds: (A:) Myosin light chain kinase, smooth muscle and non-muscle isozymes

SCOP Domain Sequences for d2cqva1:

Sequence; same for both SEQRES and ATOM records:

>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]}
pqiiqfpedqkvragesvelfgkvtgtqpitctwmkfrkqiqesehmkvensengsklti
laarqehcgcytllvenklgsrqaqvnltvvdkpdppagtp

Timeline for d2cqva1:

• d2cqva1 is new in SCOP 1.73
  
• d2cqva1 appears in SCOP 1.75
  
• d2cqva1 appears in the current release, SCOPe 2.08