Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein Polypyrimidine tract-binding protein 2, PTBP2 [143332] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143333] (1 PDB entry) |
Domain d2cq1a1: 2cq1 A:51-138 [130712] 1st RBD |
PDB Entry: 2cq1 (more details)
SCOP Domain Sequences for d2cq1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} dkmdgapsrvlhirklpgevtetevialglpfgkvtnilmlkgknqaflelateeaaitm vnyysavtphlrnqpiyiqysnhkelkt
Timeline for d2cq1a1: