Lineage for d2cq1a1 (2cq1 A:51-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952080Protein Polypyrimidine tract-binding protein 2, PTBP2 [143332] (1 species)
  7. 2952081Species Human (Homo sapiens) [TaxId:9606] [143333] (1 PDB entry)
    Uniprot Q9UKA9 51-138
  8. 2952082Domain d2cq1a1: 2cq1 A:51-138 [130712]
    Other proteins in same PDB: d2cq1a2, d2cq1a3
    1st RBD

Details for d2cq1a1

PDB Entry: 2cq1 (more details)

PDB Description: solution structure of rna binding domain in ptb-like protein l
PDB Compounds: (A:) PTB-like protein L

SCOPe Domain Sequences for d2cq1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}
dkmdgapsrvlhirklpgevtetevialglpfgkvtnilmlkgknqaflelateeaaitm
vnyysavtphlrnqpiyiqysnhkelkt

SCOPe Domain Coordinates for d2cq1a1:

Click to download the PDB-style file with coordinates for d2cq1a1.
(The format of our PDB-style files is described here.)

Timeline for d2cq1a1: