Lineage for d2cpwa1 (2cpw A:8-58)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985344Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1985368Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1985369Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1985376Protein Cbl-interacting protein p70, STS1 [140329] (1 species)
  7. 1985377Species Human (Homo sapiens) [TaxId:9606] [140330] (1 PDB entry)
    Uniprot Q8TF42 26-76
  8. 1985378Domain d2cpwa1: 2cpw A:8-58 [130707]
    Other proteins in same PDB: d2cpwa2, d2cpwa3

Details for d2cpwa1

PDB Entry: 2cpw (more details)

PDB Description: solution structure of rsgi ruh-031, a uba domain from human cdna
PDB Compounds: (A:) Cbl-interacting protein Sts-1 variant

SCOPe Domain Sequences for d2cpwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]}
rnrqqrpgtikhgsaldvllsmgfpraraqkalastggrsvqtacdwlfsh

SCOPe Domain Coordinates for d2cpwa1:

Click to download the PDB-style file with coordinates for d2cpwa1.
(The format of our PDB-style files is described here.)

Timeline for d2cpwa1: