PDB entry 2cpw

View 2cpw on RCSB PDB site
Description: Solution structure of RSGI RUH-031, a UBA domain from human cDNA
Class: Structural Genomics, Unknown Function
Keywords: Ubiquitin Associated Domain, UBA, Compact three helix bundle, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Unknown Function
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cbl-interacting protein Sts-1 variant
    Species: Homo sapiens [TaxId:9606]
    Gene: GENBANK/AB075839
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q53GT8 (7-57)
      • cloning artifact (0-6)
      • cloning artifact (58-63)
    Domains in SCOPe 2.06: d2cpwa1, d2cpwa2, d2cpwa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cpwA (A:)
    gssgssgrnrqqrpgtikhgsaldvllsmgfpraraqkalastggrsvqtacdwlfshsg
    pssg