SCOP 1.73: Domain d2cpfa1: 2cpf A:362-446

Lineage for d2cpfa1 (2cpf A:362-446)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117970] (4 PDB entries)

8. Domain d2cpfa1: 2cpf A:362-446 [130699]

Details for d2cpfa1

PDB Entry: 2cpf

PDB Description: solution structure of the penultimate rna recognition motif of hypothetical rna-binding protein rbm19

PDB Compounds: (A:) RNA binding motif protein 19

SCOP Domain Sequences for d2cpfa1:

Sequence; same for both SEQRES and ATOM records:

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}
lfiknlnfstteetlkgvfskvgaiksctiskkknkagvllsmgfgfveykkpeqaqkal
kqlqghtvdghklevriseratkpa

Timeline for d2cpfa1:

• d2cpfa1 is new in SCOP 1.73
  
• d2cpfa1 appears in SCOP 1.75
  
• d2cpfa1 appears in the current release, SCOPe 2.08