Lineage for d2cpfa1 (2cpf A:362-446)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952100Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species)
  7. 2952101Species Mouse (Mus musculus) [TaxId:10090] [117970] (4 PDB entries)
    Uniprot Q8R3C6 399-484; 581-678
  8. 2952104Domain d2cpfa1: 2cpf A:362-446 [130699]
    Other proteins in same PDB: d2cpfa2, d2cpfa3

Details for d2cpfa1

PDB Entry: 2cpf (more details)

PDB Description: solution structure of the penultimate rna recognition motif of hypothetical rna-binding protein rbm19
PDB Compounds: (A:) RNA binding motif protein 19

SCOPe Domain Sequences for d2cpfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}
lfiknlnfstteetlkgvfskvgaiksctiskkknkagvllsmgfgfveykkpeqaqkal
kqlqghtvdghklevriseratkpa

SCOPe Domain Coordinates for d2cpfa1:

Click to download the PDB-style file with coordinates for d2cpfa1.
(The format of our PDB-style files is described here.)

Timeline for d2cpfa1: