Lineage for d2cp6a1 (2cp6 A:8-167)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1537616Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 1537617Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 1537664Protein Restin [141236] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [141237] (2 PDB entries)
    Uniprot P30622 1-128! Uniprot P30622 181-340
  8. 1537667Domain d2cp6a1: 2cp6 A:8-167 [130693]
    2nd GAP-Gly domain

Details for d2cp6a1

PDB Entry: 2cp6 (more details)

PDB Description: solution structure of the 2nd cap-gly domain in human clip-170/restin
PDB Compounds: (A:) Restin

SCOPe Domain Sequences for d2cp6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cp6a1 b.34.10.1 (A:8-167) Restin {Human (Homo sapiens) [TaxId: 9606]}
atppisnltktasesisnlseagsikkgerelkigdrvlvggtkagvvrflgetdfakge
wcgveldeplgkndgavagtryfqcqpkyglfapvhkvtkigfpsttpakakanavrrvm
attsaslkrspsasslssmssvassvssrpsrtglltets

SCOPe Domain Coordinates for d2cp6a1:

Click to download the PDB-style file with coordinates for d2cp6a1.
(The format of our PDB-style files is described here.)

Timeline for d2cp6a1: