PDB entry 2cp6

View 2cp6 on RCSB PDB site
Description: Solution structure of the 2nd CAP-Gly domain in human CLIP-170/restin
Class: protein binding
Keywords: microtubule binding, cytoskeleton associated protein, restin, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2005-05-19, released 2005-11-19
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Restin
    Species: Homo sapiens [TaxId:9606]
    Gene: FB2383_D01
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30622 (7-165)
      • cloning artifact (0-6)
      • cloning artifact (166-171)
    Domains in SCOPe 2.04: d2cp6a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cp6A (A:)
    gssgssgatppisnltktasesisnlseagsikkgerelkigdrvlvggtkagvvrflge
    tdfakgewcgveldeplgkndgavagtryfqcqpkyglfapvhkvtkigfpsttpakaka
    navrrvmattsaslkrspsasslssmssvassvssrpsrtglltetsgpssg