| Class g: Small proteins [56992] (90 folds) |
| Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) ![]() |
| Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
| Protein Zinc finger and SCAN domain-containing protein 16, ZSCAN16 [144155] (1 species) Zinc finger protein 435 |
| Species Human (Homo sapiens) [TaxId:9606] [144156] (1 PDB entry) Uniprot Q9H4T2 224-261! Uniprot Q9H4T2 262-288 |
| Domain d2cota2: 2cot A:7-44 [130685] complexed with zn |
PDB Entry: 2cot (more details)
SCOPe Domain Sequences for d2cota2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]}
grsewqqrerrrykcdecgksfshssdlskhrrthtge
Timeline for d2cota2: