Lineage for d2cota2 (2cot A:7-44)

  1. Root: SCOPe 2.03
  2. 1458801Class g: Small proteins [56992] (90 folds)
  3. 1462985Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 1462986Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 1462987Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 1463168Protein Zinc finger and SCAN domain-containing protein 16, ZSCAN16 [144155] (1 species)
    Zinc finger protein 435
  7. 1463169Species Human (Homo sapiens) [TaxId:9606] [144156] (1 PDB entry)
    Uniprot Q9H4T2 224-261! Uniprot Q9H4T2 262-288
  8. 1463171Domain d2cota2: 2cot A:7-44 [130685]
    complexed with zn

Details for d2cota2

PDB Entry: 2cot (more details)

PDB Description: solution structure of the first and second zf-c2h2 domain of zinc finger protein 435
PDB Compounds: (A:) Zinc finger protein 435

SCOPe Domain Sequences for d2cota2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]}
grsewqqrerrrykcdecgksfshssdlskhrrthtge

SCOPe Domain Coordinates for d2cota2:

Click to download the PDB-style file with coordinates for d2cota2.
(The format of our PDB-style files is described here.)

Timeline for d2cota2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cota1