SCOP 1.73: Domain d2cota2: 2cot A:7-44

Lineage for d2cota2 (2cot A:7-44)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
   alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix

4. Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (6 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)

6. Protein Zinc finger and SCAN domain-containing protein 16, ZSCAN16 [144155] (1 species)
   Zinc finger protein 435

7. Species Human (Homo sapiens) [TaxId:9606] [144156] (1 PDB entry)

8. Domain d2cota2: 2cot A:7-44 [130685]
   complexed with zn

Details for d2cota2

PDB Entry: 2cot

PDB Description: solution structure of the first and second zf-c2h2 domain of zinc finger protein 435

PDB Compounds: (A:) Zinc finger protein 435

SCOP Domain Sequences for d2cota2:

Sequence; same for both SEQRES and ATOM records:

>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]}
grsewqqrerrrykcdecgksfshssdlskhrrthtge

Timeline for d2cota2:

• d2cota2 is new in SCOP 1.73
  
• d2cota2 appears in SCOP 1.75
  
• d2cota2 appears in the current release, SCOPe 2.08