Class g: Small proteins [56992] (100 folds) |
Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily) simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC |
Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) |
Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins) |
Protein Zinc finger and SCAN domain-containing protein 16, ZSCAN16 [144155] (1 species) Zinc finger protein 435 |
Species Human (Homo sapiens) [TaxId:9606] [144156] (1 PDB entry) Uniprot Q9H4T2 224-261! Uniprot Q9H4T2 262-288 |
Domain d2cota2: 2cot A:8-44 [130685] Other proteins in same PDB: d2cota3, d2cota4 complexed with zn |
PDB Entry: 2cot (more details)
SCOPe Domain Sequences for d2cota2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cota2 g.37.1.1 (A:8-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} rsewqqrerrrykcdecgksfshssdlskhrrthtge
Timeline for d2cota2: