Class g: Small proteins [56992] (100 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Nedd9 interacting protein with calponin homology, NICAL (MICAL1) [144173] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144174] (1 PDB entry) Uniprot Q8TDZ2 687-722! Uniprot Q8TDZ2 723-755 |
Domain d2co8a1: 2co8 A:44-76 [130670] Other proteins in same PDB: d2co8a3, d2co8a4 complexed with zn |
PDB Entry: 2co8 (more details)
SCOPe Domain Sequences for d2co8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} rchtceatlwpggyeqhpgdghfyclqhlpqtd
Timeline for d2co8a1: