Lineage for d2co8a1 (2co8 A:44-76)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035825Protein Nedd9 interacting protein with calponin homology, NICAL (MICAL1) [144173] (1 species)
  7. 3035826Species Human (Homo sapiens) [TaxId:9606] [144174] (1 PDB entry)
    Uniprot Q8TDZ2 687-722! Uniprot Q8TDZ2 723-755
  8. 3035827Domain d2co8a1: 2co8 A:44-76 [130670]
    Other proteins in same PDB: d2co8a3, d2co8a4
    complexed with zn

Details for d2co8a1

PDB Entry: 2co8 (more details)

PDB Description: solution structures of the lim domain of human nedd9 interacting protein with calponin homology and lim domains
PDB Compounds: (A:) NEDD9 interacting protein with calponin homology and LIM domains

SCOPe Domain Sequences for d2co8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]}
rchtceatlwpggyeqhpgdghfyclqhlpqtd

SCOPe Domain Coordinates for d2co8a1:

Click to download the PDB-style file with coordinates for d2co8a1.
(The format of our PDB-style files is described here.)

Timeline for d2co8a1: