PDB entry 2co8

View 2co8 on RCSB PDB site
Description: Solution structures of the LIM domain of human NEDD9 interacting protein with calponin homology and LIM domains
Class: metal binding protein
Keywords: LIM domain, zinc finger protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2005-05-17, released 2005-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NEDD9 interacting protein with calponin homology and LIM domains
    Species: Homo sapiens [TaxId:9606]
    Gene: NICAL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TDZ2 (7-75)
      • cloning artifact (0-6)
      • cloning artifact (76-81)
    Domains in SCOPe 2.08: d2co8a1, d2co8a2, d2co8a3, d2co8a4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2co8A (A:)
    gssgssgqhqeagagdlcalcgehlyvlerlcvnghffhrscfrchtceatlwpggyeqh
    pgdghfyclqhlpqtdsgpssg