Lineage for d2cnbd_ (2cnb D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2090553Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 protein domains)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2091795Protein automated matches [190085] (51 species)
    not a true protein
  7. 2092245Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [187036] (1 PDB entry)
  8. 2092249Domain d2cnbd_: 2cnb D: [130639]
    automated match to d1gy8a_
    complexed with nad, ufg

Details for d2cnbd_

PDB Entry: 2cnb (more details), 2.7 Å

PDB Description: trypanosoma brucei udp-galactose-4-epimerase in ternary complex with nad and the substrate analogue udp-4-deoxy-4-fluoro-alpha-d-galactose
PDB Compounds: (D:) udp-galactose-4-epimerase

SCOPe Domain Sequences for d2cnbd_:

Sequence, based on SEQRES records: (download)

>d2cnbd_ c.2.1.2 (D:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
vvgilrllqamllhkcdkiifsssaaifgnptmgsvstnaepidinakkspespygeskl
iaermirdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiapdq
rltihedastdkrmpifgtdyptpdgtcvrdyvhvcdlasahilaldyveklgpndksky
fsvfnlgtsrgysvrevievarkttghpipvrecgrregdpaylvaasdkarevlgwkpk
ydtleaimetswkfqrthpngya

Sequence, based on observed residues (ATOM records): (download)

>d2cnbd_ c.2.1.2 (D:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
shmrvlvcggagyigshfvrallrdtnhsvvivdslvgthgksdhvetrenvarklqqsd
gpkppwadryaalevgdvrnedflngvftrhgpidavvhmcaflavgesvrdplkyydnn
vvgilrllqamllhkcdkiifsssaaifgnptnaepidinakkspespygeskliaermi
rdcaeaygikgiclryfnacgahedgdigehyqgsthlipiilgrvmsdiadkrmpifgt
dyptpdgtcvrdyvhvcdlasahilaldyveklgpndkskyfsvfnlgtsrgysvrevie
varkttghpipvrecgrregdpaylvaasdkarevlgwkpkydtleaimetswkfqrthp
ngya

SCOPe Domain Coordinates for d2cnbd_:

Click to download the PDB-style file with coordinates for d2cnbd_.
(The format of our PDB-style files is described here.)

Timeline for d2cnbd_: