SCOP 1.75: Domain d2cleb1: 2cle B:3-394

Lineage for d2cleb1 (2cle B:3-394)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (47 PDB entries)

8. Domain d2cleb1: 2cle B:3-394 [130573]
   Other proteins in same PDB: d2clea1
   automatically matched to d1bksb_
   complexed with f6f, na, plp

Details for d2cleb1

PDB Entry: 2cle, 1.5 Å

PDB Description: tryptophan synthase in complex with n-(4'-trifluoromethoxybenzoyl)-2-amino-1-ethylphosphate (f6) -lowf6 complex

PDB Compounds: (B:) tryptophan synthase beta chain

SCOP Domain Sequences for d2cleb1:

Sequence; same for both SEQRES and ATOM records:

>d2cleb1 c.79.1.1 (B:3-394) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdilkar

Timeline for d2cleb1:

• d2cleb1 first appeared in SCOP 1.73
  
• d2cleb1 appears in SCOPe 2.01
  
• d2cleb1 appears in the current release, SCOPe 2.08