Lineage for d2cleb1 (2cle B:3-394)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708963Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 708964Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 708965Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 709129Protein Tryptophan synthase, beta-subunit [53688] (2 species)
  7. 709141Species Salmonella typhimurium [TaxId:90371] [53689] (42 PDB entries)
  8. 709148Domain d2cleb1: 2cle B:3-394 [130573]
    Other proteins in same PDB: d2clea1
    automatically matched to d1bksb_
    complexed with f6f, na, plp

Details for d2cleb1

PDB Entry: 2cle (more details), 1.5 Å

PDB Description: tryptophan synthase in complex with n-(4'-trifluoromethoxybenzoyl)-2-amino-1-ethylphosphate (f6) -lowf6 complex
PDB Compounds: (B:) tryptophan synthase beta chain

SCOP Domain Sequences for d2cleb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cleb1 c.79.1.1 (B:3-394) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 602]}
tllnpyfgefggmyvpqilmpalnqleeafvraqkdpefqaqfadllknyagrptaltkc
qnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasala
sallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsye
tahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmfa
dfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysisa
gldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkmm
reqpekeqllvvnlsgrgdkdiftvhdilkar

SCOP Domain Coordinates for d2cleb1:

Click to download the PDB-style file with coordinates for d2cleb1.
(The format of our PDB-style files is described here.)

Timeline for d2cleb1: