SCOPe 2.08: Domain d2ckua1: 2cku A:108-151

Lineage for d2ckua1 (2cku A:108-151)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.27: FnI-like domain [57602] (1 superfamily)
   disulfide-rich, all-beta

4. Superfamily g.27.1: FnI-like domain [57603] (3 families)

5. Family g.27.1.0: automated matches [254219] (1 protein)
   not a true family

6. Protein automated matches [254499] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255088] (1 PDB entry)

8. Domain d2ckua1: 2cku A:108-151 [130568]
   automated match to d1fbra2

Details for d2ckua1

PDB Entry: 2cku

PDB Description: solution structure of 2f13f1 from human fibronectin

PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d2ckua1:

Sequence; same for both SEQRES and ATOM records:

>d2ckua1 g.27.1.0 (A:108-151) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrcheggqsykigdtwrrphetggymlecvclgngkgewtckpi

Timeline for d2ckua1:

• d2ckua1 first appeared in SCOP 1.73
  
• d2ckua1 appears in SCOPe 2.07