Lineage for d2ckua2 (2cku A:63-107)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034865Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 3034866Superfamily g.27.1: FnI-like domain [57603] (3 families) (S)
  5. 3034924Family g.27.1.0: automated matches [254219] (1 protein)
    not a true family
  6. 3034925Protein automated matches [254499] (1 species)
    not a true protein
  7. 3034926Species Human (Homo sapiens) [TaxId:9606] [255088] (1 PDB entry)
  8. 3034928Domain d2ckua2: 2cku A:63-107 [130569]
    automated match to d2rkya1

Details for d2ckua2

PDB Entry: 2cku (more details)

PDB Description: solution structure of 2f13f1 from human fibronectin
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d2ckua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckua2 g.27.1.0 (A:63-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eetcfdkytgntyrvgdtyerpkdsmiwdctcigagrgrisctia

SCOPe Domain Coordinates for d2ckua2:

Click to download the PDB-style file with coordinates for d2ckua2.
(The format of our PDB-style files is described here.)

Timeline for d2ckua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ckua1