SCOPe 2.01: Domain d2cj7a_: 2cj7 A:

Lineage for d2cj7a_ (2cj7 A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (2 families)
   contains a short alpha-hairpin at the N-terminal extension

5. Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (3 proteins)
   Pfam PF04043

6. Protein automated matches [190250] (1 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [187032] (6 PDB entries)

8. Domain d2cj7a_: 2cj7 A: [130522]
   automated match to d1rj1a_
   complexed with iod

Details for d2cj7a_

PDB Entry: 2cj7, 1.8 Å

PDB Description: crystal structure of a cell wall invertase inhibitor from tobacco (ph 9.0)

PDB Compounds: (A:) invertase inhibitor

SCOPe Domain Sequences for d2cj7a_:

Sequence, based on SEQRES records:

>d2cj7a_ a.29.6.1 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg
skspfsalniavhelsdvgraivrnll

Sequence, based on observed residues (ATOM records):

>d2cj7a_ a.29.6.1 (A:) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfks
pfsalniavhelsdvgraivrnll

Timeline for d2cj7a_:

• d2cj7a_ first appeared in SCOP 1.73, called d2cj7a1
  
• d2cj7a_ was called d2cj7a1 in SCOP 1.75
  
• d2cj7a_ appears in SCOPe 2.02
  
• d2cj7a_ appears in the current release, SCOPe 2.08