Lineage for d2cj7a1 (2cj7 A:4-150)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639849Fold a.29: Bromodomain-like [47363] (10 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 639988Superfamily a.29.6: Plant invertase/pectin methylesterase inhibitor [101148] (1 family) (S)
    contains a short alpha-hairpin at the N-terminal extension
  5. 639989Family a.29.6.1: Plant invertase/pectin methylesterase inhibitor [101149] (2 proteins)
    Pfam PF04043
  6. 639990Protein Invertase inhibitor [101150] (1 species)
  7. 639991Species Common tobacco (Nicotiana tabacum) [TaxId:4097] [101151] (7 PDB entries)
  8. 639994Domain d2cj7a1: 2cj7 A:4-150 [130522]
    automatically matched to d1rj1a_
    complexed with iod

Details for d2cj7a1

PDB Entry: 2cj7 (more details), 1.8 Å

PDB Description: crystal structure of a cell wall invertase inhibitor from tobacco (ph 9.0)
PDB Compounds: (A:) invertase inhibitor

SCOP Domain Sequences for d2cj7a1:

Sequence, based on SEQRES records: (download)

>d2cj7a1 a.29.6.1 (A:4-150) Invertase inhibitor {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}
nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfkg
skspfsalniavhelsdvgraivrnll

Sequence, based on observed residues (ATOM records): (download)

>d2cj7a1 a.29.6.1 (A:4-150) Invertase inhibitor {Common tobacco (Nicotiana tabacum) [TaxId: 4097]}
nnlvettckntpnyqlclktllsdkrsatgdittlalimvdaikakanqaavtisklrhs
nppaawkgplkncafsykviltaslpeaiealtkgdpkfaedgmvgssgdaqeceeyfks
pfsalniavhelsdvgraivrnll

SCOP Domain Coordinates for d2cj7a1:

Click to download the PDB-style file with coordinates for d2cj7a1.
(The format of our PDB-style files is described here.)

Timeline for d2cj7a1: