Lineage for d2chnb2 (2chn B:127-436)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.10: alpha-D-glucuronidase/Hyaluronidase catalytic domain [82253] (4 proteins)
    Glycosyl hydrolase family 67, GH67; structurally related to GH20; contains extra C-terminal alpha-helical subdomain
  6. Protein Glucosaminidase GH84, catalytic domain [141790] (1 species)
  7. Species Bacteroides thetaiotaomicron [TaxId:818] [141791] (8 PDB entries)
    Uniprot Q89ZI2 148-457
  8. Domain d2chnb2: 2chn B:127-436 [130477]
    Other proteins in same PDB: d2chna1, d2chna3, d2chnb1, d2chnb3
    automatically matched to 2CHN A:127-436
    complexed with ca, gol, ngt

Details for d2chnb2

PDB Entry: 2chn (more details), 1.95 Å

PDB Description: bacteroides thetaiotaomicron hexosaminidase with o-glcnacase activity- nag-thiazoline complex
PDB Compounds: (B:) glucosaminidase

SCOPe Domain Sequences for d2chnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2chnb2 c.1.8.10 (B:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]}
vryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdkeaa
qlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffddisg
egtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnpsiq
imwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttiakem
sgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfamhns
dlgpnghgyr

SCOPe Domain Coordinates for d2chnb2 are not available.

Timeline for d2chnb2:

Domains from same chain:
(mouse over for more information)
d2chnb1, d2chnb3
Domains from other chains:
(mouse over for more information)
d2chna1, d2chna2, d2chna3