Lineage for d2chna3 (2chn A:4-126)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528985Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2530337Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2530408Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. 2530409Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)
  7. 2530410Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries)
    Uniprot Q89ZI2 25-147
  8. 2530420Domain d2chna3: 2chn A:4-126 [130475]
    Other proteins in same PDB: d2chna1, d2chna2, d2chnb1, d2chnb2
    complexed with ca, gol, ngt

Details for d2chna3

PDB Entry: 2chn (more details), 1.95 Å

PDB Description: bacteroides thetaiotaomicron hexosaminidase with o-glcnacase activity- nag-thiazoline complex
PDB Compounds: (A:) glucosaminidase

SCOPe Domain Sequences for d2chna3:

Sequence, based on SEQRES records: (download)

>d2chna3 d.92.2.3 (A:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
yps

Sequence, based on observed residues (ATOM records): (download)

>d2chna3 d.92.2.3 (A:4-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkys
rqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

SCOPe Domain Coordinates for d2chna3:

Click to download the PDB-style file with coordinates for d2chna3.
(The format of our PDB-style files is described here.)

Timeline for d2chna3: