Lineage for d2chnb3 (2chn B:5-126)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. Family d.92.2.3: Hyaluronidase N-terminal domain-like [143618] (2 proteins)
  6. Protein Glucosaminidase GH84, N-terminal domain [143621] (1 species)
  7. Species Bacteroides thetaiotaomicron [TaxId:818] [143622] (8 PDB entries)
    Uniprot Q89ZI2 25-147
  8. Domain d2chnb3: 2chn B:5-126 [130478]
    Other proteins in same PDB: d2chna1, d2chna2, d2chnb1, d2chnb2
    automatically matched to 2CHN A:4-126
    complexed with ca, gol, ngt

Details for d2chnb3

PDB Entry: 2chn (more details), 1.95 Å

PDB Description: bacteroides thetaiotaomicron hexosaminidase with o-glcnacase activity- nag-thiazoline complex
PDB Compounds: (B:) glucosaminidase

SCOPe Domain Sequences for d2chnb3:

Sequence, based on SEQRES records: (download)

>d2chnb3 d.92.2.3 (B:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekgd
ksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdy
ps

Sequence, based on observed residues (ATOM records): (download)

>d2chnb3 d.92.2.3 (B:5-126) Glucosaminidase GH84, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
lqpppqqlivqnktidlpavyqlnggeeanphavkvlkellgmlisigekgdksvrkysr
qipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikdyps

SCOPe Domain Coordinates for d2chnb3 are not available.

Timeline for d2chnb3:

Domains from same chain:
(mouse over for more information)
d2chnb1, d2chnb2
Domains from other chains:
(mouse over for more information)
d2chna1, d2chna2, d2chna3