SCOPe 2.07: Domain d2ch1b_: 2ch1 B:

Lineage for d2ch1b_ (2ch1 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [187029] (2 PDB entries)

8. Domain d2ch1b_: 2ch1 B: [130440]
   Other proteins in same PDB: d2ch1a1
   automated match to d1h0ca_
   complexed with gol, plp

Details for d2ch1b_

PDB Entry: 2ch1, 2.4 Å

PDB Description: Structure of Anopheles gambiae 3-hydroxykynurenine transaminase

PDB Compounds: (B:) 3-hydroxykynurenine transaminase

SCOPe Domain Sequences for d2ch1b_:

Sequence; same for both SEQRES and ATOM records:

>d2ch1b_ c.67.1.0 (B:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
kftpppaslrnpliipekimmgpgpsncskrvltamtntvlsnfhaelfrtmdevkdglr
yifqtenratmcvsgsahagmeamlsnlleegdrvliavngiwaeravemserygadvrt
iegppdrpfsletlaraielhqpkclflthgdsssgllqplegvgqichqhdcllivdav
aslcgvpfymdkweidavytgaqkvlgappgitpisispkaldvirnrrtkskvfywdll
llgnywgcydepkryhhtvasnlifalrealaqiaeeglenqikrriecaqilyeglgkm
gldifvkdprhrlptvtgimipkgvdwwkvsqyamnnfslevqgglgptfgkawrvgimg
ecstvqkiqfylygfkeslkathpdyif

Timeline for d2ch1b_:

• d2ch1b_ first appeared in SCOP 1.73, called d2ch1b1
  
• d2ch1b_ appears in SCOPe 2.06
  
• d2ch1b_ appears in the current release, SCOPe 2.08