Class a: All alpha proteins [46456] (284 folds) |
Fold a.269: FtsH protease domain-like [140989] (1 superfamily) array of 6 helices and a 2-stranded beta-ribbon |
Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) contains zincin-like ((55486)) metal-binding motif HExxH, embedded into a topologically different fold |
Family a.269.1.1: FtsH protease domain-like [140991] (1 protein) Pfam PF01434; Peptidase family M41 |
Protein Cell division protein FtsH, C-terminal domain [140992] (2 species) |
Species Thermotoga maritima [TaxId:2336] [140994] (2 PDB entries) Uniprot Q9WZ49 411-603 |
Domain d2ce7d1: 2ce7 D:411-603 [130318] Other proteins in same PDB: d2ce7a2, d2ce7b2, d2ce7c2, d2ce7d2, d2ce7e2, d2ce7f2 automatically matched to 2CE7 A:411-603 complexed with adp, mg, zn; mutant |
PDB Entry: 2ce7 (more details), 2.44 Å
SCOP Domain Sequences for d2ce7d1:
Sequence, based on SEQRES records: (download)
>d2ce7d1 a.269.1.1 (D:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgkee qevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleke tiegdelrrilse
>d2ce7d1 a.269.1.1 (D:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} lispaekriiayheaghavvstvvpngepvhrisiiprgyylvsrnelldkltallggra aeevvfgdvtsgaandierateiarnmvcqlgmseelgplawglrnyseevaskideevk kivtncyerakeiirkyrkqldniveilleketiegdelrrilse
Timeline for d2ce7d1: