Lineage for d2ce7b1 (2ce7 B:411-603)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 781161Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
    array of 6 helices and a 2-stranded beta-ribbon
  4. 781162Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) (S)
    contains zincin-like ((55486)) metal-binding motif HExxH, embedded into a topologically different fold
  5. 781163Family a.269.1.1: FtsH protease domain-like [140991] (1 protein)
    Pfam PF01434; Peptidase family M41
  6. 781164Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)
  7. 781168Species Thermotoga maritima [TaxId:2336] [140994] (2 PDB entries)
    Uniprot Q9WZ49 411-603
  8. 781170Domain d2ce7b1: 2ce7 B:411-603 [130314]
    Other proteins in same PDB: d2ce7a2, d2ce7b2, d2ce7c2, d2ce7d2, d2ce7e2, d2ce7f2
    automatically matched to 2CE7 A:411-603
    complexed with adp, mg, zn; mutant

Details for d2ce7b1

PDB Entry: 2ce7 (more details), 2.44 Å

PDB Description: edta treated
PDB Compounds: (B:) cell division protein ftsh

SCOP Domain Sequences for d2ce7b1:

Sequence, based on SEQRES records: (download)

>d2ce7b1 a.269.1.1 (B:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn
elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgkee
qevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleke
tiegdelrrilse

Sequence, based on observed residues (ATOM records): (download)

>d2ce7b1 a.269.1.1 (B:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiiylvsrnelldkltallggraaeev
vfgdvtsgaandierateiarnmvcqlgmseelgplawgklrnyseevaskideevkkiv
tncyerakeiirkyrkqldniveilleketiegdelrrilse

SCOP Domain Coordinates for d2ce7b1:

Click to download the PDB-style file with coordinates for d2ce7b1.
(The format of our PDB-style files is described here.)

Timeline for d2ce7b1: