Lineage for d2ce7d1 (2ce7 D:411-603)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 928878Fold a.269: FtsH protease domain-like [140989] (1 superfamily)
    array of 6 helices and a 2-stranded beta-ribbon
  4. 928879Superfamily a.269.1: FtsH protease domain-like [140990] (1 family) (S)
    contains zincin-like (55486) metal-binding motif HExxH, embedded into a topologically different fold
  5. 928880Family a.269.1.1: FtsH protease domain-like [140991] (1 protein)
    Pfam PF01434; Peptidase family M41
  6. 928881Protein Cell division protein FtsH, C-terminal domain [140992] (2 species)
  7. 928885Species Thermotoga maritima [TaxId:2336] [140994] (2 PDB entries)
    Uniprot Q9WZ49 411-603
  8. 928889Domain d2ce7d1: 2ce7 D:411-603 [130318]
    Other proteins in same PDB: d2ce7a2, d2ce7b2, d2ce7c2, d2ce7d2, d2ce7e2, d2ce7f2
    automatically matched to 2CE7 A:411-603
    complexed with adp, mg, zn

Details for d2ce7d1

PDB Entry: 2ce7 (more details), 2.44 Å

PDB Description: edta treated
PDB Compounds: (D:) cell division protein ftsh

SCOPe Domain Sequences for d2ce7d1:

Sequence, based on SEQRES records: (download)

>d2ce7d1 a.269.1.1 (D:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiiprgykalgytlhlpeedkylvsrn
elldkltallggraaeevvfgdvtsgaandierateiarnmvcqlgmseelgplawgkee
qevflgkeitrlrnyseevaskideevkkivtncyerakeiirkyrkqldniveilleke
tiegdelrrilse

Sequence, based on observed residues (ATOM records): (download)

>d2ce7d1 a.269.1.1 (D:411-603) Cell division protein FtsH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
lispaekriiayheaghavvstvvpngepvhrisiiprgyylvsrnelldkltallggra
aeevvfgdvtsgaandierateiarnmvcqlgmseelgplawglrnyseevaskideevk
kivtncyerakeiirkyrkqldniveilleketiegdelrrilse

SCOPe Domain Coordinates for d2ce7d1:

Click to download the PDB-style file with coordinates for d2ce7d1.
(The format of our PDB-style files is described here.)

Timeline for d2ce7d1: