SCOP 1.75: Domain d2cdqa1: 2cdq A:25-328

Lineage for d2cdqa1 (2cdq A:25-328)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (3 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.3: PyrH-like [142721] (3 proteins)
   part of Pfam PF00696

6. Protein Aspartokinase [142724] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142725] (1 PDB entry)
   Uniprot Q9LYU8 84-387

8. Domain d2cdqa1: 2cdq A:25-328 [130290]
   Other proteins in same PDB: d2cdqa2, d2cdqa3, d2cdqb2, d2cdqb3
   complexed with lys, sam, tar

Details for d2cdqa1

PDB Entry: 2cdq, 2.85 Å

PDB Description: crystal structure of arabidopsis thaliana aspartate kinase complexed with lysine and s-adenosylmethionine

PDB Compounds: (A:) aspartokinase

SCOP Domain Sequences for d2cdqa1:

Sequence; same for both SEQRES and ATOM records:

>d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kgitcvmkfggssvasaermkevadliltfpeespvivlsamgkttnnlllagekavscg
vsnaseieelsiikelhirtvkelnidpsviltyleeleqllkgiammkeltlrtrdylv
sfgeclstrifaaylntigvkarqydafeigfittddftngdileatypavakrlyddwm
hdpavpivtgflgkgwktgavttlgrggsdltattigkalglkeiqvwkdvdgvltcdpt
iykratpvpyltfdeaaelayfgaqvlhpqsmrparegeipvrvknsynpkapgtiitkt
rdmt

Timeline for d2cdqa1:

• d2cdqa1 first appeared in SCOP 1.73
  
• d2cdqa1 appears in SCOPe 2.01
  
• d2cdqa1 appears in the current release, SCOPe 2.08