Lineage for d2cdqa1 (2cdq A:25-328)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2478893Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 2478894Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 2478971Family c.73.1.3: PyrH-like [142721] (4 proteins)
    part of Pfam PF00696
  6. 2478972Protein Aspartokinase [142724] (3 species)
  7. 2478982Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [142725] (1 PDB entry)
    Uniprot Q9LYU8 84-387
  8. 2478983Domain d2cdqa1: 2cdq A:25-328 [130290]
    Other proteins in same PDB: d2cdqa2, d2cdqa3, d2cdqb2, d2cdqb3
    complexed with lys, sam, tar

Details for d2cdqa1

PDB Entry: 2cdq (more details), 2.85 Å

PDB Description: crystal structure of arabidopsis thaliana aspartate kinase complexed with lysine and s-adenosylmethionine
PDB Compounds: (A:) aspartokinase

SCOPe Domain Sequences for d2cdqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdqa1 c.73.1.3 (A:25-328) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
kgitcvmkfggssvasaermkevadliltfpeespvivlsamgkttnnlllagekavscg
vsnaseieelsiikelhirtvkelnidpsviltyleeleqllkgiammkeltlrtrdylv
sfgeclstrifaaylntigvkarqydafeigfittddftngdileatypavakrlyddwm
hdpavpivtgflgkgwktgavttlgrggsdltattigkalglkeiqvwkdvdgvltcdpt
iykratpvpyltfdeaaelayfgaqvlhpqsmrparegeipvrvknsynpkapgtiitkt
rdmt

SCOPe Domain Coordinates for d2cdqa1:

Click to download the PDB-style file with coordinates for d2cdqa1.
(The format of our PDB-style files is described here.)

Timeline for d2cdqa1: