SCOP 1.75: Domain d2cdqb3: 2cdq B:420-494

Lineage for d2cdqb3 (2cdq B:420-494)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (14 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
   duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family

6. Protein Aspartokinase [143391] (3 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [143394] (1 PDB entry)
   Uniprot Q9LYU8 388-478! Uniprot Q9LYU8 479-553

8. Domain d2cdqb3: 2cdq B:420-494 [130295]
   Other proteins in same PDB: d2cdqa1, d2cdqb1
   automatically matched to 2CDQ A:420-494
   complexed with lys, sam, tar

Details for d2cdqb3

PDB Entry: 2cdq, 2.85 Å

PDB Description: crystal structure of arabidopsis thaliana aspartate kinase complexed with lysine and s-adenosylmethionine

PDB Compounds: (B:) aspartokinase

SCOP Domain Sequences for d2cdqb3:

Sequence; same for both SEQRES and ATOM records:

>d2cdqb3 d.58.18.10 (B:420-494) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
raiislignvqhsslilerafhvlytkgvnvqmisqgaskvnisfivneaeaegcvqalh
ksffesgdlselliq

Timeline for d2cdqb3:

• d2cdqb3 first appeared in SCOP 1.73
  
• d2cdqb3 appears in SCOPe 2.01
  
• d2cdqb3 appears in the current release, SCOPe 2.08