Lineage for d2ccib2 (2cci B:309-432)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003388Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2003401Protein Cyclin A [47956] (2 species)
  7. 2003437Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
    Uniprot P20248 175-432
  8. 2003717Domain d2ccib2: 2cci B:309-432 [130244]
    Other proteins in same PDB: d2ccia2, d2ccia3, d2ccic2, d2ccic3
    automatically matched to d1vin_2
    protein/DNA complex; complexed with atp, mg

Details for d2ccib2

PDB Entry: 2cci (more details), 2.7 Å

PDB Description: crystal structure of phospho-cdk2 cyclin a in complex with a peptide containing both the substrate and recruitment sites of cdc6
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2ccib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccib2 a.74.1.1 (B:309-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl

SCOPe Domain Coordinates for d2ccib2:

Click to download the PDB-style file with coordinates for d2ccib2.
(The format of our PDB-style files is described here.)

Timeline for d2ccib2: