SCOP 1.73: Domain d2cc2b2: 2cc2 B:8-192

Lineage for d2cc2b2 (2cc2 B:8-192)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold

4. Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family)

5. Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein)

6. Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)

7. Species Streptomyces cattleya [TaxId:29303] [102525] (9 PDB entries)

8. Domain d2cc2b2: 2cc2 B:8-192 [130215]
   Other proteins in same PDB: d2cc2a1, d2cc2b1, d2cc2c1
   automatically matched to d1rqpa2
   complexed with 5ad, cl

Details for d2cc2b2

PDB Entry: 2cc2, 2 Å

PDB Description: x-ray crystal structure of 5'-fluorodeoxyadenosine synthase from streptomyces cattleya complexed with 5'deoxyadenosine

PDB Compounds: (B:) 5'-fluoro-5'-deoxyadenosine synthase

SCOP Domain Sequences for d2cc2b2:

Sequence; same for both SEQRES and ATOM records:

>d2cc2b2 c.132.1.1 (B:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

Timeline for d2cc2b2:

• d2cc2b2 is new in SCOP 1.73
  
• d2cc2b2 appears in SCOP 1.75
  
• d2cc2b2 appears in the current release, SCOPe 2.08