Lineage for d1rqpa2 (1rqp A:8-192)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 713497Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 713498Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family) (S)
  5. 713499Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein)
  6. 713500Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species)
  7. 713501Species Streptomyces cattleya [TaxId:29303] [102525] (9 PDB entries)
  8. 713502Domain d1rqpa2: 1rqp A:8-192 [97755]
    Other proteins in same PDB: d1rqpa1, d1rqpb1, d1rqpc1

Details for d1rqpa2

PDB Entry: 1rqp (more details), 1.8 Å

PDB Description: Crystal structure and mechanism of a bacterial fluorinating enzyme
PDB Compounds: (A:) 5'-fluoro-5'-deoxyadenosine synthase

SCOP Domain Sequences for d1rqpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqpa2 c.132.1.1 (A:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]}
rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp
egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll
ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei
vrfnr

SCOP Domain Coordinates for d1rqpa2:

Click to download the PDB-style file with coordinates for d1rqpa2.
(The format of our PDB-style files is described here.)

Timeline for d1rqpa2: