Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold |
Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (1 family) |
Family c.132.1.1: Bacterial fluorinating enzyme, N-terminal domain [102523] (1 protein) |
Protein 5'-fluoro-5'-deoxyadenosine synthase [102524] (1 species) |
Species Streptomyces cattleya [TaxId:29303] [102525] (9 PDB entries) |
Domain d2cc2a2: 2cc2 A:8-192 [130213] Other proteins in same PDB: d2cc2a1, d2cc2b1, d2cc2c1 automatically matched to d1rqpa2 complexed with 5ad, cl |
PDB Entry: 2cc2 (more details), 2 Å
SCOP Domain Sequences for d2cc2a2:
Sequence, based on SEQRES records: (download)
>d2cc2a2 c.132.1.1 (A:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp egtvfatttypatgtttrsvavrikqaakggargqwagsgagferaegsyiyiapnngll ttvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledhei vrfnr
>d2cc2a2 c.132.1.1 (A:8-192) 5'-fluoro-5'-deoxyadenosine synthase {Streptomyces cattleya [TaxId: 29303]} rpiiafmsdlgttddsvaqckglmysicpdvtvvdvchsmtpwdveegaryivdlprffp egtvfatttypatgtttrsvavrikqaakggagqwagsgagferaegsyiyiapnngllt tvleehgyleayevtspkvipeqpeptfysremvaipsahlaagfplsevgrpledheiv rfnr
Timeline for d2cc2a2:
View in 3D Domains from other chains: (mouse over for more information) d2cc2b1, d2cc2b2, d2cc2c1, d2cc2c2 |