SCOP 1.73: Domain d2cbya1: 2cby A:15-193

Lineage for d2cbya1 (2cby A:15-193)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (4 families)

5. Family c.14.1.1: Clp protease, ClpP subunit [52097] (1 protein)

6. Protein Clp protease, ClpP subunit [52098] (5 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [141997] (2 PDB entries)

8. Domain d2cbya1: 2cby A:15-193 [130202]

Details for d2cbya1

PDB Entry: 2cby, 2.6 Å

PDB Description: crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis

PDB Compounds: (A:) ATP-dependent clp protease proteolytic subunit 1

SCOP Domain Sequences for d2cbya1:

Sequence, based on SEQRES records:

>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra

Sequence, based on observed residues (ATOM records):

>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra

Timeline for d2cbya1:

• d2cbya1 is new in SCOP 1.73
  
• d2cbya1 appears in SCOP 1.75
  
• d2cbya1 appears in the current release, SCOPe 2.08