Lineage for d2cbya1 (2cby A:15-193)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852296Protein Clp protease, ClpP subunit [52098] (11 species)
  7. 2852450Species Mycobacterium tuberculosis [TaxId:1773] [141997] (1 PDB entry)
    Uniprot P0A526 15-193
  8. 2852451Domain d2cbya1: 2cby A:15-193 [130202]
    Other proteins in same PDB: d2cbyb_, d2cbyc_, d2cbyd_, d2cbye_, d2cbyf_, d2cbyg_

Details for d2cbya1

PDB Entry: 2cby (more details), 2.6 Å

PDB Description: crystal structure of the atp-dependent clp protease proteolytic subunit 1 (clpp1) from mycobacterium tuberculosis
PDB Compounds: (A:) ATP-dependent clp protease proteolytic subunit 1

SCOPe Domain Sequences for d2cbya1:

Sequence, based on SEQRES records: (download)

>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqplggvtgsaa
diaiqaeqfavikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra

Sequence, based on observed residues (ATOM records): (download)

>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]}
sltdsvyerllseriiflgsevndeianrlcaqilllaaedaskdislyinspggsisag
maiydtmvlapcdiatyamgmaasmgefllaagtkgkryalpharilmhqpiaiqaeqfa
vikkemfrlnaeftgqpierieadsdrdrwftaaealeygfvdhiitra

SCOPe Domain Coordinates for d2cbya1:

Click to download the PDB-style file with coordinates for d2cbya1.
(The format of our PDB-style files is described here.)

Timeline for d2cbya1: