![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.4: ITPase-like [52972] (4 families) ![]() formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
![]() | Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins) Pfam PF01725 |
![]() | Protein Inosine triphosphate pyrophosphatase, ITPase [142426] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142427] (1 PDB entry) Uniprot Q9BY32 1-194 |
![]() | Domain d2cara1: 2car A:1-194 [130161] Other proteins in same PDB: d2carb_ |
PDB Entry: 2car (more details), 1.09 Å
SCOPe Domain Sequences for d2cara1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cara1 c.51.4.1 (A:1-194) Inosine triphosphate pyrophosphatase, ITPase {Human (Homo sapiens) [TaxId: 9606]} maaslvgkkivfvtgnakkleevvqilgdkfpctlvaqkidlpeyqgepdeisiqkcqea vrqvqgpvlvedtclcfnalgglpgpyikwfleklkpeglhqllagfedksayalctfal stgdpsqpvrlfrgrtsgrivaprgcqdfgwdpcfqpdgyeqtyaempkaeknavshrfr allelqeyfgslaa
Timeline for d2cara1: