![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.4: ITPase-like [52972] (4 families) ![]() formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
![]() | Family c.51.4.0: automated matches [191335] (1 protein) not a true family |
![]() | Protein automated matches [190179] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187020] (7 PDB entries) |
![]() | Domain d2carb_: 2car B: [130162] Other proteins in same PDB: d2cara1 automated match to d1v7ra_ |
PDB Entry: 2car (more details), 1.09 Å
SCOPe Domain Sequences for d2carb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2carb_ c.51.4.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} maaslvgkkivfvtgnakkleevvqilgdkfpctlvaqkidlpeyqgepdeisiqkcqea vrqvqgpvlvedtclcfnalgglpgpyikwfleklkpeglhqllagfedksayalctfal stgdpsqpvrlfrgrtsgrivaprgcqdfgwdpcfqpdgyeqtyaempkaeknavshrfr allelqeyfgslaa
Timeline for d2carb_: