SCOPe 2.04: Domain d2c78a3: 2c78 A:9-212

Lineage for d2c78a3 (2c78 A:9-212)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (24 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255082] (2 PDB entries)

8. Domain d2c78a3: 2c78 A:9-212 [130039]
   Other proteins in same PDB: d2c78a1, d2c78a2
   automated match to d1b23p3
   complexed with gnp, mg, pul

Details for d2c78a3

PDB Entry: 2c78, 1.4 Å

PDB Description: ef-tu complexed with a gtp analog and the antibiotic pulvomycin

PDB Compounds: (A:) elongation factor tu-a

SCOPe Domain Sequences for d2c78a3:

Sequence; same for both SEQRES and ATOM records:

>d2c78a3 c.37.1.8 (A:9-212) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kphvnvgtighvdhgkttltaaltyvaaaenpnvevkdygdidkapeerargitintahv
eyetakrhyshvdcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehillarqvgv
pyivvfmnkvdmvddpelldlvemevrdllnqyefpgdevpvirgsallaleqmhrnpkt
rrgenewvdkiwelldaideyipt

Timeline for d2c78a3:

• d2c78a3 first appeared in SCOP 1.73
  
• d2c78a3 appears in SCOPe 2.03
  
• d2c78a3 appears in SCOPe 2.05
  
• d2c78a3 appears in the current release, SCOPe 2.08