| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (3 families) ![]() duplication: consists of two domains of this fold |
| Family a.74.1.1: Cyclin [47955] (8 proteins) |
| Protein Cyclin A [47956] (2 species) |
| Species Cow (Bos taurus) [TaxId:9913] [47958] (25 PDB entries) |
| Domain d2c6tb2: 2c6t B:309-432 [130006] Other proteins in same PDB: d2c6ta_, d2c6tc_ automatically matched to d1vin_2 complexed with dt5 |
PDB Entry: 2c6t (more details), 2.61 Å
SCOPe Domain Sequences for d2c6tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c6tb2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvt
gqswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppe
tlnl
Timeline for d2c6tb2:
View in 3DDomains from other chains: (mouse over for more information) d2c6ta_, d2c6tc_, d2c6td1, d2c6td2 |