Lineage for d2c6tb2 (2c6t B:310-432)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. Protein Cyclin A [47956] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47957] (88 PDB entries)
    Uniprot P20248 175-432
  8. Domain d2c6tb2: 2c6t B:310-432 [130006]
    Other proteins in same PDB: d2c6ta_, d2c6tc_
    automated match to d1h1pb2
    complexed with dt5

Details for d2c6tb2

PDB Entry: 2c6t (more details), 2.61 Å

PDB Description: crystal structure of the human cdk2 complexed with the triazolopyrimidine inhibitor
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2c6tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c6tb2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

SCOPe Domain Coordinates for d2c6tb2 are not available.

Timeline for d2c6tb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c6tb1
View in 3D
Domains from other chains:
(mouse over for more information)
d2c6ta_, d2c6tc_, d2c6td1, d2c6td2