SCOPe 2.08: Domain d2c42a1: 2c42 A:2-258

Lineage for d2c42a1 (2c42 A:2-258)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.8: PFOR Pyr module [88746] (1 protein)
   domains VI, I and II are arranged in the same way as the TK PP, Pyr and C domains
   automatically mapped to Pfam PF01855

6. Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain I [88747] (1 species)

7. Species Desulfovibrio africanus [TaxId:873] [88748] (10 PDB entries)

8. Domain d2c42a1: 2c42 A:2-258 [129790]
   Other proteins in same PDB: d2c42a2, d2c42a3, d2c42a4, d2c42a5, d2c42b2, d2c42b3, d2c42b4, d2c42b5
   automated match to d1keka1
   complexed with ca, mg, pyr, sf4, tpp

Details for d2c42a1

PDB Entry: 2c42, 1.78 Å

PDB Description: Crystal Structure Of Pyruvate-Ferredoxin Oxidoreductase From Desulfovibrio africanus

PDB Compounds: (A:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d2c42a1:

Sequence; same for both SEQRES and ATOM records:

>d2c42a1 c.36.1.8 (A:2-258) Pyruvate-ferredoxin oxidoreductase, PFOR, domain I {Desulfovibrio africanus [TaxId: 873]}
gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
ivaeymqkvasltgrsy

Timeline for d2c42a1:

• d2c42a1 first appeared in SCOP 1.73
  
• d2c42a1 appears in SCOPe 2.07