Lineage for d2c3ub3 (2c3u B:259-415)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1169947Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 1169948Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 1170058Family c.48.1.3: Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52931] (1 protein)
  6. 1170059Protein Pyruvate-ferredoxin oxidoreductase, PFOR, domain II [52932] (1 species)
  7. 1170060Species Desulfovibrio africanus [TaxId:873] [52933] (10 PDB entries)
  8. 1170074Domain d2c3ub3: 2c3u B:259-415 [129777]
    Other proteins in same PDB: d2c3ua1, d2c3ua2, d2c3ua4, d2c3ua5, d2c3ub1, d2c3ub2, d2c3ub4, d2c3ub5
    automatically matched to d1b0pa3
    complexed with 2tp, ca, mg, pyr, sf4

Details for d2c3ub3

PDB Entry: 2c3u (more details), 2.32 Å

PDB Description: crystal structure of pyruvate-ferredoxin oxidoreductase from desulfovibrio africanus, oxygen inhibited form
PDB Compounds: (B:) pyruvate-ferredoxin oxidoreductase

SCOPe Domain Sequences for d2c3ub3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c3ub3 c.48.1.3 (B:259-415) Pyruvate-ferredoxin oxidoreductase, PFOR, domain II {Desulfovibrio africanus [TaxId: 873]}
klfdyvgapdaervivsmgsscetieevinhlaakgekiglikvrlyrpfvseaffaalp
asakvitvldrtkepgapgdplyldvcsafvergeampkilagryglgskefspamvksv
ydnmsgakknhftvgieddvtgtslpvdnafadttpk

SCOPe Domain Coordinates for d2c3ub3:

Click to download the PDB-style file with coordinates for d2c3ub3.
(The format of our PDB-style files is described here.)

Timeline for d2c3ub3: